Protein coding transcript 206341

• Transcript: Ll_transcript_268671
• CDS coordinates: 1162-1890 (+)
• Peptide sequence: MCRTLEVLARNQRERNDLGSQPLPMAIYVVSGDEDGERGGAPVVCIEDASRRCSEFSRGLAAWTPLLLLVPLVLGLDKINLRYVPLLQSTFKFPQSLGILGGKPGASTYIIGVQNEKAFYLDPHDVHPVVNINGDNQEADTSSYHSNIIRLMPLDSIDPSLAIGFYCRNKDDFDNFCSRASDLVEESNGAPLFTVAQSRSLPMQVSSSNDASGANSGFQEDDALGLDLVNDAETNEDDWQLL*
• ORF Type: complete

Annotations of Ll_transcript_268671

• Blastp: Cysteine protease ATG4 from Medicago with 81.82% of identity
• Blastx: Cysteine protease ATG4 from Medicago with 73.56% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_7g081230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413861.1)
• Pfam: Peptidase family C54 (PF03416.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;