Protein coding transcript 206347

• Transcript: Ll_transcript_269117
• CDS coordinates: 431-1252 (+)
• Peptide sequence: MSLSGNVSLLCQILYNMDNRICFASVFLFLFISLQKDVDFESPEAKKQVRGSTSSKKSRAAEVHNLSERRRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQMMSMGCGMVPMMFAGMQPYMPAMGMGMGMGLGMEMGMNRQVMPFPNMLAGSALPATTPHLGPRFPMPPFHMPHVPAPDSSRMQAMNQTHNNMRNSVAMPVPNQSCIPNITDPYQQYLAPHQMQFQLMQNQAMNQLNISKPSTSRAPEKPENHQSGEKMIV*
• ORF Type: complete

Annotations of Ll_transcript_269117

• Blastp: Transcription factor PIF1 from Arabidopsis with 53.74% of identity
• Blastx: Transcription factor PIF1 from Arabidopsis with 56.99% of identity
• Eggnog: Transcription factor(ENOG41116VE)
• Kegg: Link to kegg annotations (AT2G20180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457098.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;