Protein coding transcript 206349

• Transcript: Ll_transcript_269133
• CDS coordinates: 221-790 (+)
• Peptide sequence: MRALQELIPRCNKSDKASMLDDAIEYLKSLQLQVQMMSMGCGMVPMMFAGMHPYMPAMAMGMGMGMDMGMNRPVMPFANVLAGSALPAATAAAHLGPRFPMPPFHMPHVPAPDSSQMQATNQSDNSMLNSVGTPVPNQSCIPNFNNPYQYLGPHQMQFQLMQNQAMNQLNVSKPSTSRGPENPEHHQSG*
• ORF Type: complete

Annotations of Ll_transcript_269133

• Blastp: Transcription factor PIF1 from Arabidopsis with 50.87% of identity
• Blastx: Transcription factor PIF1 from Arabidopsis with 86.67% of identity
• Eggnog: Transcription factor(ENOG41116VE)
• Kegg: Link to kegg annotations (AT2G20180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444409.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;