Protein coding transcript 206350

• Transcript: Ll_transcript_269137
• CDS coordinates: 1-756 (+)
• Peptide sequence: RKGREQEESDFQSEDVDFESPEAKKQVRGSTSSKKSRAAEVHNLSERRRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQMMSMGCGMVPMMFAGMQPYMPAMGMGMGMGLGMEMGMNRQVMPFPNMLAGSALPATTPHLGPRFPMPPFHMPHVPAPDSSRMQAMNQTHNNMRNSVAMPVPNQSCIPNITDPYQQYLAPHQMQFQLMQNQAMNQLNISKPSTSRAPEKPENHQSGEKMIV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_269137

• Blastp: Transcription factor PIF1 from Arabidopsis with 50.61% of identity
• Blastx: Transcription factor PIF3 from Arabidopsis with 70.21% of identity
• Eggnog: Transcription factor(ENOG41116VE)
• Kegg: Link to kegg annotations (AT2G20180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457098.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;