Protein coding transcript 2065

• Transcript: Ll_transcript_318538
• CDS coordinates: 3-317 (+)
• Peptide sequence: SIDELQEIEKQLERSVGSVRARKTQVFKEQIQQLKEKEKALDAENSMLSEKYGIYPEPVTKDHRENQPQPCEESSPSNSDVDTGLFIGLPDTRPRRISPTQPFS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_318538

• Blastp: MADS-box protein SOC1 from Arabidopsis with 57.78% of identity
• Blastx: MADS-box protein SOC1 from Arabidopsis with 57.78% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT2G45660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454597.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;