Protein coding transcript 206512

• Transcript: Ll_transcript_249826
• CDS coordinates: 530-877 (+)
• Peptide sequence: MLNVVIGANRGIGFSICKQLASVVVTPRDEMVGLEAIEKLKQLHVTDPASIRLLEDFIRIQLDISVCITNLYLYLHMSIALCLVKVLEHKSGFTFIIIQVNRFLQAFVHFQLYIC*
• ORF Type: complete

Annotations of Ll_transcript_249826

• Blastp: (+)-neomenthol dehydrogenase from Arabidopsis with 53.09% of identity
• Blastx: (+)-neomenthol dehydrogenase from Arabidopsis with 52.63% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (AT3G61220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434219.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;