Transcript | Ll_transcript_249849 |
---|---|
CDS coordinates | 754-1278 (+) |
Peptide sequence | MTQTYELAEECLEINYYGAKITNESLLPLLQLSDSPRIVNVSSSLGMLQYVSNEWSRGVLSDADNLTEERVDEVLKGFLKDFKEGLLEIKGWPKTLSAYIVSKAAMNAYTRILAKKYPNICTNAVCPGYVKTDITCNTGLSTVEEGAAYPVRLALLSNETSSGLFYSGSEVSSF* |
ORF Type | complete |
Blastp | (+)-neomenthol dehydrogenase from Arabidopsis with 61.71% of identity |
---|---|
Blastx | (+)-neomenthol dehydrogenase from Arabidopsis with 57.84% of identity |
Eggnog | Dehydrogenase reductase(COG1028) |
Kegg | Link to kegg annotations (AT3G61220) |
CantataDB | Link to cantataDB annotations (CNT0000966) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443635.1) |
Pfam | Enoyl-(Acyl carrier protein) reductase (PF13561.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer