Protein coding transcript 206523

• Transcript: Ll_transcript_249850
• CDS coordinates: 1247-1768 (+)
• Peptide sequence: MTQTYELAEECLEINYYGAKITNESLLPLLQLSDSPRIVNVSSSLGMLQYVSNEWSRGVLSDADNLTEERVDEVLKGFLKDFKEGLLEIKGWPKTLSAYIVSKAAMNAYTRILAKKYPNICTNAVCPGYVKTDITCNTGLSTVEEGAAYPVSNLHPCSRSSIGHWVQDHCMISC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_249850

• Blastp: (+)-neomenthol dehydrogenase from Arabidopsis with 62.25% of identity
• Blastx: (+)-neomenthol dehydrogenase from Arabidopsis with 57.56% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (AT3G61220)
• CantataDB: Link to cantataDB annotations (CNT0000966)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443635.1)
• Pfam: Enoyl-(Acyl carrier protein) reductase (PF13561.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;