Transcript | Ll_transcript_250791 |
---|---|
CDS coordinates | 706-1026 (+) |
Peptide sequence | MYAIGGSANPTINSQGNRYLAPLNSHAKEVTKRVETGEDTGEDTWKNWNWRSDGDLLLNGAYFTASGAGSAASYARASSLSAQSSSVVGTLTSAAGVLNCRRGTMC* |
ORF Type | complete |
Blastp | Probable pectate lyase 15 from Arabidopsis with 69.81% of identity |
---|---|
Blastx | Probable pectate lyase 5 from Arabidopsis with 87.6% of identity |
Eggnog | pectate lyase activity(COG3866) |
Kegg | Link to kegg annotations (AT4G13710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001242543.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer