Protein coding transcript 206549

• Transcript: Ll_transcript_250792
• CDS coordinates: 706-1071 (+)
• Peptide sequence: MYAIGGSANPTINSQGNRYLAPLNSHAKEVTKRVETGEDTGEDTWKNWNWRSDGDLLLNGAYFTASGAGSAASYARASSLSAQSSSVVGTLTSAAGVLNCRRDFVGKHQAKTNGSFYTSKNH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_250792

• Blastp: Probable pectate lyase 15 from Arabidopsis with 70.59% of identity
• Blastx: Probable pectate lyase 5 from Arabidopsis with 87.6% of identity
• Eggnog: pectate lyase activity(COG3866)
• Kegg: Link to kegg annotations (AT4G13710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001242543.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;