Transcript | Ll_transcript_250798 |
---|---|
CDS coordinates | 2-724 (+) |
Peptide sequence | QYVTNVIVHGINIHDCKQGGNAMVRDSPRHYGWRTISDGDGVSIFGGSHIWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFVAPNDRFSKEVTKHEDAPENEWKGWNWRSEGDLLVNGAFFTASGAGASSSYARASSLSARPSSLVGSITTGAGALSCRKGSTC* |
ORF Type | 5prime_partial |
Blastp | Probable pectate lyase 22 from Arabidopsis with 84.3% of identity |
---|---|
Blastx | Probable pectate lyase 22 from Arabidopsis with 79.34% of identity |
Eggnog | pectate lyase activity(COG3866) |
Kegg | Link to kegg annotations (AT5G63180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457441.1) |
Pfam | Pectate lyase (PF00544.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer