Transcript | Ll_transcript_248383 |
---|---|
CDS coordinates | 657-1130 (+) |
Peptide sequence | MDEGGGSKLSGIRQIVRLKEILQKWQNVTLGPKTYDSKRTCPDPRRTSSEPSCGATSSSISPLINKRITSVIGCDSDEEGCLSPEPPHDVPKGYLAVYVGPELRRFIIPTTYLSHFLFKVLLEKAEDEYGFDQSGGLTIPCEIETFKYLLKCIETNP* |
ORF Type | complete |
Blastp | Indole-3-acetic acid-induced protein ARG7 from Vigna with 49.28% of identity |
---|---|
Blastx | Auxin-responsive protein SAUR32 from Arabidopsis with 55.07% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414483.1) |
Pfam | Auxin responsive protein (PF02519.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer