Protein coding transcript 206559

• Transcript: Ll_transcript_248380
• CDS coordinates: 405-893 (+)
• Peptide sequence: MEDVGGSKLKALGQIARLKEMFQKWQTTSMGSQESNDHSHVKHGGILPMINKRLTNLVYCDSDEESCYSPEAPHDVPKGYLAVYVGPEHRRFIIPTSYLSHSLFKVLLEKAAEEFGFDQSGGLTIPCEIETFKYLMNCMENTRKEDHDDTCKLIKIFTFHFM*
• ORF Type: complete

Annotations of Ll_transcript_248380

• Blastp: Indole-3-acetic acid-induced protein ARG7 from Vigna with 54.55% of identity
• Blastx: Indole-3-acetic acid-induced protein ARG7 from Vigna with 54.55% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462808.1)
• Pfam: Auxin responsive protein (PF02519.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;