Transcript | Ll_transcript_248392 |
---|---|
CDS coordinates | 235-708 (+) |
Peptide sequence | MEDVGGSKLKALGQIARLKEMFQKWQTTSMGSQESNDHSHVKHGGILPMINKRLTNLVYCDSDEESCYSPEAPHDVPKGYLAVYVGPEHRRFIIPTSYLSHSLFKVLLEKAAEEFGFDQSGGLTIPCEIETFKYLMNCMENTRKEDHDDTSGNTGTI* |
ORF Type | complete |
Blastp | Indole-3-acetic acid-induced protein ARG7 from Vigna with 54.55% of identity |
---|---|
Blastx | Auxin-induced protein 15A from Soja with 54.55% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462808.1) |
Pfam | Auxin responsive protein (PF02519.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer