Transcript | Ll_transcript_250672 |
---|---|
CDS coordinates | 1891-2613 (+) |
Peptide sequence | MSERGFHVIHTYGLSETYGPSTICAWKPEWDSLPPEKKAKLHARQGVRYISLEGLDVMNTKTMQPVPADGITIGEIMMRGNGVMKGYLKNPKANEEAFANGWFHSGDLAVKHPDGYIEIKDRSKDIIISGAENISSVEIENALYSHPAILEASVVARPDEKWGESPCAFVTLKNGVVDSGDEQNLAEDIIKFCRSKMPAYWVPKSVVFGPLPKTSTGKVQKNLLRAKAKEMGPVKIISKL* |
ORF Type | complete |
Blastp | Acetate/butyrate--CoA ligase AAE7, peroxisomal from Arabidopsis with 75.64% of identity |
---|---|
Blastx | Acetate/butyrate--CoA ligase AAE7, peroxisomal from Arabidopsis with 74.92% of identity |
Eggnog | Amp-dependent synthetase and ligase(COG0318) |
Kegg | Link to kegg annotations (AT3G16910) |
CantataDB | Link to cantataDB annotations (CNT0001009) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419699.1) |
Pfam | AMP-binding enzyme (PF00501.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer