Protein coding transcript 206585

• Transcript: Ll_transcript_250675
• CDS coordinates: 464-886 (+)
• Peptide sequence: MQRRSPPKHRHDGTSPLPLGMDWSPAPRKWNGRDTVWPHNHRSGWSYCVTIPSWVFLPKSKNSDPIVFYRVQVGIQSPEGVTTLHGVLRRFNDFLKLFADLKKEFSRKSIPPAPPKGFTQLKSRALLEEVGNSLTYYSTS*
• ORF Type: complete

Annotations of Ll_transcript_250675

• Blastp: PX domain-containing protein EREL2 from Arabidopsis with 74.82% of identity
• Blastx: PX domain-containing protein EREL1 from Arabidopsis with 69.18% of identity
• Eggnog: Domain-Containing protein(ENOG4110T18)
• Kegg: Link to kegg annotations (AT2G25350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415544.1)
• Pfam: PX domain (PF00787.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;