Protein coding transcript 206594

• Transcript: Ll_transcript_250661
• CDS coordinates: 460-1269 (+)
• Peptide sequence: MQRRSPPKHRHDGTSPLPLGMDWSPAPRKWNGRDTVWPHNHRSGWSYCVTIPSWVFLPKSKNSDPIVFYRVQVGIQSPEGVTTLHGVLRRFNDFLKLFADLKKEFSRKSIPPAPPKGFTQLKSRALLEERRCSLEEWMTKLLSDIDISRCAAVASFLGLETAARSSFQDTSQQNSETDPDSNNIAYSVQPPLHSSLSLLAGSSSVASDNGSDTAYETSELGTPRVGRDDNSEVGTDDLTLDEYTTNPMERLVKYGISNIDEGVFIGQTIL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_250661

• Blastp: PX domain-containing protein EREL1 from Arabidopsis with 68.86% of identity
• Blastx: PX domain-containing protein EREL1 from Arabidopsis with 67.28% of identity
• Eggnog: Domain-Containing protein(ENOG4110T18)
• Kegg: Link to kegg annotations (AT4G32160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415544.1)
• Pfam: PX domain (PF00787.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;