Transcript | Ll_transcript_318448 |
---|---|
CDS coordinates | 1-531 (+) |
Peptide sequence | FSSSTLIETFSIKNNSLLFLCEMAKVQKDQEIQGIKLFGTTIKYGEEESKKKQEGKEDETMEKKPEKIIACPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAKPPCHGGGFREGCIYETSNDENKFGLVLEEWEVAMPQSSFRQPCTAKRLRMSSGG* |
ORF Type | 5prime_partial |
Blastp | Cyclic dof factor 4 from Arabidopsis with 54.07% of identity |
---|---|
Blastx | Dof zinc finger protein DOF1.5 from Arabidopsis with 51.74% of identity |
Eggnog | Dof-type zinc finger domain-containing protein(ENOG4111564) |
Kegg | Link to kegg annotations (AT2G34140) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425156.1) |
Pfam | Dof domain, zinc finger (PF02701.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer