Protein coding transcript 206650

• Transcript: Ll_transcript_249687
• CDS coordinates: 301-621 (+)
• Peptide sequence: MLSQQKTIINAMAVNEDGVMVTGGDNGSMWFWDWKCGHNFQQSQTIVQPGSLDSEAGIYALTYDATGTRLITCEADKTIKMWKEDESATPETFPLNFRPPKDIRRF*
• ORF Type: complete

Annotations of Ll_transcript_249687

• Blastp: Protein pleiotropic regulatory locus 1 from Arabidopsis with 85.85% of identity
• Blastx: Protein pleiotropic regulatory locus 1 from Arabidopsis with 86.82% of identity
• Eggnog: Pleiotropic regulator 1(ENOG410XQV9)
• Kegg: Link to kegg annotations (AT4G15900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439289.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;