Transcript | Ll_transcript_249696 |
---|---|
CDS coordinates | 267-1031 (+) |
Peptide sequence | MFSAGDDKQVKCWDLEQNKVIRSYHGHLSGVYCLALHPTIDVLLTGGRDSVCRVWDIRSKMQIHALSGHDNTVCSVFTRPTDPQVVTGSHDSTIKMWDLRYGKTMLTLTNHKKSVRAMAPHPKEQAFASASADNIKKFNLPKGEFCHNMLSQQKTIINAMAVNEDGVMVTGGDNGSMWFWDWKCGHNFQQSQTIVQPGSLDSEAGIYALTYDATGTRLITCEADKTIKMWKEDESATPETFPLNFRPPKDIRRF* |
ORF Type | complete |
Blastp | Protein pleiotropic regulatory locus 1 from Arabidopsis with 89.37% of identity |
---|---|
Blastx | Protein pleiotropic regulatory locus 1 from Arabidopsis with 89.02% of identity |
Eggnog | Pleiotropic regulator 1(ENOG410XQV9) |
Kegg | Link to kegg annotations (AT4G15900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439289.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer