Protein coding transcript 206684

• Transcript: Ll_transcript_249562
• CDS coordinates: 50-490 (+)
• Peptide sequence: MATAPALEQVQCFGRKKTAVAVTYCKRGRGLIKINGSPIELVEPEILRFKAFEPVLLLGKSRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR*
• ORF Type: complete

Annotations of Ll_transcript_249562

• Blastp: 40S ribosomal protein S16-3 from Arabidopsis with 88.36% of identity
• Blastx: 40S ribosomal protein S16-3 from Arabidopsis with 88.36% of identity
• Eggnog: 30S ribosomal protein S9(COG0103)
• Kegg: Link to kegg annotations (AT5G18380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422309.1)
• Pfam: Ribosomal protein S9/S16 (PF00380.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;