Protein coding transcript 206708

• Transcript: Ll_transcript_248706
• CDS coordinates: 871-1545 (+)
• Peptide sequence: MIGNGVTDGKFDGINALIPFVHGMGLISDNIYEDLQAYCKGQYRNDANVKCTEIIEKVYKAIDGLNVYDILEPCYHNPEAEASKGNRSSLPLSFQQLGTTDKPLPVRKRMFGRAWPFLAPVQQGLLPLWPQLLAQIRHVDCVNDEVASSWLNNAQVRKAIHAEQETVAGPWEICTDRIEYYGNAGNSMIPYHKNLTKLGYRALIFRCKCAIMHACLNLSTDISG*
• ORF Type: complete

Annotations of Ll_transcript_248706

• Blastp: Serine carboxypeptidase 1 from Hordeum with 54.15% of identity
• Blastx: Serine carboxypeptidase 1 from Hordeum with 60.12% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439878.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;