Protein coding transcript 206729

• Transcript: Ll_transcript_249739
• CDS coordinates: 186-878 (+)
• Peptide sequence: MFCSFRSVLYVPTFNHNMVSFSSNVKAQGLCFSRAGEATLRSHSVSVDHNMPQTRVCVGRALKPNNMIEIHSAEKLVHFLVNAGDALVVVDFYSPGCGGCKTLHPKICQIAGLYPNVAFVKVNYEEMKSMCYSLQIHVLPFFRFYKGTEGRVCSFSCTNATIKKFKDALAKHGNERCKLGPARGLDEKELKALASVGEISANSQLLCHKSEATRGKEHARVVYMDALNFQ*
• ORF Type: complete

Annotations of Ll_transcript_249739

• Blastp: Thioredoxin-like 1-1, chloroplastic from Arabidopsis with 66.88% of identity
• Blastx: Thioredoxin-like 1-1, chloroplastic from Arabidopsis with 66.88% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (AT1G08570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463434.1)
• Pfam: Phosducin (PF02114.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;