Protein coding transcript 206766

• Transcript: Ll_transcript_249866
• CDS coordinates: 2-334 (+)
• Peptide sequence: HGIPPELLHRTLAAMKAFHEQPPEQRSQVYRREMGRGVSYISNVDLFQSKAASWRDTLQIRLGPVAADREEVPEVCREEVLEWDKEVVRVEEVPEVCREEVLEWDKEVVRV
• ORF Type: internal

Annotations of Ll_transcript_249866

• Blastp: 1-aminocyclopropane-1-carboxylate oxidase homolog 2 from Arabidopsis with 40.22% of identity
• Blastx: 1-aminocyclopropane-1-carboxylate oxidase homolog 2 from Arabidopsis with 45.31% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT1G06640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434975.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;