Protein coding transcript 206767

• Transcript: Ll_transcript_249867
• CDS coordinates: 2-796 (+)
• Peptide sequence: HGIPPELLHRTLAAMKAFHEQPPEQRSQVYRREMGRGVSYISNVDLFQSKAASWRDTLQIRLGPVTAGREEVPEVCREQVLEWDKEVVRVGEVLLGLLSEGLGLGAERFREFVEGRVLVGHYYPFCPQPDLTVGLNSHADPGALTVLLQDHVGGLQVRSKEGWVDVNPVPGALVINIGDLLQIISNDEYKSADHRVLANSSGEPRVSVAVFLNPSSREKVFGPLPELTSTEKPALYRNFTLPEFLTRFFKKGLDGKTLTNFFRL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_249867

• Blastp: 1-aminocyclopropane-1-carboxylate oxidase homolog 4 from Arabidopsis with 50.94% of identity
• Blastx: 1-aminocyclopropane-1-carboxylate oxidase homolog 4 from Arabidopsis with 50.94% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT1G03400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462065.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;