Transcript | Ll_transcript_250090 |
---|---|
CDS coordinates | 330-1109 (+) |
Peptide sequence | MVSSSFSGLTSAHINKPLKNQLLLPDSLPNTIDTDNIELDFSDVFGPVTVPTSVEVDNIDSFAAESVEESNELVYDDPEVIYTRSHSLVGPSTCISQSLKLSKLTIHESKESFELVEHVTRETIDELQESSFKNGIVEKSLNGDDGNIMKIPKVSIEDFDILKVVGQGAFAKVYQVRKKGTSQIYAMKVMRKDKIMEKNHAEYMKAERDILTKIEHPYVVQLRYSFQVYFVIKKFVTARFNSLVLRFHDDVPLTSTQTQ* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase AtPK2/AtPK19 from Arabidopsis with 52.77% of identity |
---|---|
Blastx | Serine/threonine-protein kinase AtPK2/AtPK19 from Arabidopsis with 86.76% of identity |
Eggnog | protein serine/threonine kinase activity(ENOG410XNPH) |
Kegg | Link to kegg annotations (AT3G08720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413764.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer