Protein coding transcript 206846

• Transcript: Ll_transcript_248289
• CDS coordinates: 386-859 (+)
• Peptide sequence: MWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFTGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLRDGKWGEEDAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTRNPGDQVFSGSTCKQGEIEAIVIATGVHTFSGK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_248289

• Blastp: ATPase 8, plasma membrane-type from Arabidopsis with 91.14% of identity
• Blastx: ATPase 8, plasma membrane-type from Arabidopsis with 87.5% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (AT3G42640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417373.1)
• Pfam: E1-E2 ATPase (PF00122.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;