Protein coding transcript 206848

• Transcript: Ll_transcript_248290
• CDS coordinates: 401-757 (+)
• Peptide sequence: MWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFTGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLRDGKWGEEEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_248290

• Blastp: ATPase 6, plasma membrane-type from Arabidopsis with 94.07% of identity
• Blastx: ATPase 6, plasma membrane-type from Arabidopsis with 90.48% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (AT2G07560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446103.1)
• Pfam: E1-E2 ATPase (PF00122.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;