Protein coding transcript 206879

• Transcript: Ll_transcript_248202
• CDS coordinates: 174-548 (+)
• Peptide sequence: MGAPISTLYLLAYNSLQAIGWTVSLTKILYNVVSTSSLQGTYASAVHLISFLQCAAFLEVIHGAIGLVPSGALLPLMQWGGRTHFLLAVVAKLDEVQELPSVFITFLAWSISEVNYSFQWMYFI*
• ORF Type: complete

Annotations of Ll_transcript_248202

• Blastp: Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 from Mus with 35.04% of identity
• Blastx: Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 from Mus with 34.96% of identity
• Eggnog: Protein tyrosine phosphatase-like(COG5198)
• Kegg: Link to kegg annotations (70757)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454028.1)
• Pfam: Protein tyrosine phosphatase-like protein, PTPLA (PF04387.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;