Protein coding transcript 206880

• Transcript: Ll_transcript_248206
• CDS coordinates: 174-599 (+)
• Peptide sequence: MGAPISTLYLLAYNSLQAIGWTVSLTKILYNVVSTSSLQGTYASAVHLISFLQCAAFLEVIHGAIGLVPSGALLPLMQWGGRTHFLLAVVAKLDEVQELPSVFITFLAWSISELHRKLSLFDNLSQVHCVYIAVPFGSRSW*
• ORF Type: complete

Annotations of Ll_transcript_248206

• Blastp: Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 from Mus with 34.21% of identity
• Blastx: Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 from Bos with 33.33% of identity
• Eggnog: Protein tyrosine phosphatase-like(COG5198)
• Kegg: Link to kegg annotations (70757)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454027.1)
• Pfam: Protein tyrosine phosphatase-like protein, PTPLA (PF04387.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;