Transcript | Ll_transcript_250556 |
---|---|
CDS coordinates | 480-923 (+) |
Peptide sequence | MAQKGMAQQILKLGIVDIEYKRVPCDYKNQKLAVRVEESSQKPNYLAIQFLYQGGQTEIVAVDVARVGSSNWSFMSRKQGAVWDTSRVPQGPLQFRIVVTAGYDGKWIWAQKVLPADWKTGMVYDSGVQITDIAQEGCSPCHEGNWS* |
ORF Type | complete |
Blastp | Expansin-like A2 from Arabidopsis with 67.13% of identity |
---|---|
Blastx | Expansin-like A2 from Arabidopsis with 66.67% of identity |
Eggnog | expansin-like(ENOG410YDTV) |
Kegg | Link to kegg annotations (AT4G38400) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450911.1) |
Pfam | Pollen allergen (PF01357.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer