Protein coding transcript 206909

• Transcript: Ll_transcript_250560
• CDS coordinates: 40-456 (+)
• Peptide sequence: MALFLCFFIFFFASPAAAAAACDSCVHQTKASQFSKASALSSGACGYGSFALGLSNGQLAAAVPSLFKDGAGCGACFQIRCKNPTLCTKAGTRVVVSDLNHNNQTDFVLSSRAFTAMAQKGMAQQILKLGIVDIEYKR*
• ORF Type: complete

Annotations of Ll_transcript_250560

• Blastp: Expansin-like A1 from Arabidopsis with 60.87% of identity
• Blastx: Expansin-like A2 from Arabidopsis with 65.55% of identity
• Eggnog: expansin-like(ENOG410YDTV)
• Kegg: Link to kegg annotations (AT3G45970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450911.1)
• Pfam: Lytic transglycolase (PF03330.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;