Protein coding transcript 206913

• Transcript: Ll_transcript_250533
• CDS coordinates: 197-772 (+)
• Peptide sequence: MYNLMQIRCKNPTLCTKAGTRVVVSDLNHNNQTDFVLSSRAFTAMAQKGMAQQILKLGIVDIEYKRVPCDYKNQKLAVRVEESSQKPNYLAIQFLYQGGQTEIVAVDVARVGSSNWSFMSRKQGAVWDTSRVPQGPLQFRIVVTAGYDGKWIWAQKVLPADWKTGMVYDSGVQITDIAQEGCSPCHEGNWS*
• ORF Type: complete

Annotations of Ll_transcript_250533

• Blastp: Expansin-like A2 from Arabidopsis with 66.67% of identity
• Blastx: Expansin-like A2 from Arabidopsis with 67.02% of identity
• Eggnog: expansin-like(ENOG410YDTV)
• Kegg: Link to kegg annotations (AT4G38400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450911.1)
• Pfam: Pollen allergen (PF01357.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;