Transcript | Ll_transcript_250437 |
---|---|
CDS coordinates | 2-400 (+) |
Peptide sequence | PGDMEPEDGFALREWRRQNAIQLEGKEKRAKELRAKIIEEAEEYKVAFYEKRKLNVDTNKVQNREREKLYLTNQDKFHKEADKNYWKAISEIIPREVPNIEKKRGKKDQEKQPSVKVIQGPKPGKPTDLSRLR |
ORF Type | internal |
Blastp | Clathrin light chain 1 from Arabidopsis with 70.87% of identity |
---|---|
Blastx | Clathrin light chain 1 from Arabidopsis with 70.87% of identity |
Eggnog | clathrin light chain(ENOG410YB93) |
Kegg | Link to kegg annotations (AT2G20760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421942.1) |
Pfam | Clathrin light chain (PF01086.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer