Protein coding transcript 206935

• Transcript: Ll_transcript_250417
• CDS coordinates: 60-635 (+)
• Peptide sequence: MSFDAFSVDSSSDHHFATASDHHADNYSGYGGYSSFTGVFSPDSDIAVDHIAAASPEIYGFSDQNPGYSQSPFESVIVENENENGNGYGEGDAIFISDGPVLPPPGEMEPEEGYVLREWRRQNAIQLEEREKKEKELRVKIMEEAEEYKVAFYEKRKLNVDTNKVQNREREKVRRTSFMIYFFHSIFNAFY*
• ORF Type: complete

Annotations of Ll_transcript_250417

• Blastp: Clathrin light chain 1 from Arabidopsis with 44.72% of identity
• Blastx: Clathrin light chain 1 from Oryza sativa with 70.13% of identity
• Eggnog: clathrin light chain(ENOG410YB93)
• Kegg: Link to kegg annotations (AT2G20760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020221578.1)
• Pfam: Clathrin light chain (PF01086.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;