Protein coding transcript 206972

• Transcript: Ll_transcript_248826
• CDS coordinates: 163-555 (+)
• Peptide sequence: MANANLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPSQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLRYLYLSYFSLLDLHVLLDLFSS*
• ORF Type: complete

Annotations of Ll_transcript_248826

• Blastp: Ubiquitin-conjugating enzyme E2 36 from Arabidopsis with 98.15% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 36 from Arabidopsis with 98.11% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT1G16890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425255.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;