Protein coding transcript 206974

• Transcript: Ll_transcript_248829
• CDS coordinates: 47-313 (+)
• Peptide sequence: MAAPKVRFLTKIYHPNIDKLGRKCLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA*
• ORF Type: complete

Annotations of Ll_transcript_248829

• Blastp: Ubiquitin-conjugating enzyme E2 36 from Arabidopsis with 98.86% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 36 from Arabidopsis with 99.03% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT1G16890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425255.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;