Protein coding transcript 207004

• Transcript: Ll_transcript_250162
• CDS coordinates: 247-879 (+)
• Peptide sequence: MTTMRRFCCNDLLRFTAVNLDHLTETFNMSFYMTYLARWPDYFHVALAPGNRIMGYIMGKVEGQGESWHGHVTAVTVAPEFRRQQLAKKLMNLLENISDNNYNAYFVDLFVRASNAPAIKMYEKLGYVIYRRVLRYYSGEEDGLDMRKALSRDVEKKSVIPLKRPITPDELEVMKNREDKRFHESTHLLYTFCVVCFFLVSLIFMLSVYVK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_250162

• Blastp: N-terminal acetyltransferase B complex catalytic subunit NAA20 from Arabidopsis with 91.28% of identity
• Blastx: N-terminal acetyltransferase B complex catalytic subunit NAA20 from Arabidopsis with 91.28% of identity
• Eggnog: acetyltransferase(COG0456)
• Kegg: Link to kegg annotations (AT1G03150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427876.1)
• Pfam: Acetyltransferase (GNAT) family (PF00583.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;