Protein coding transcript 207052

• Transcript: Ll_transcript_250598
• CDS coordinates: 1619-2221 (+)
• Peptide sequence: MKNSLKNIFLFSDPSQYALPLMICHINIQFVNGLQSLISPTPLGTPLPLTLLGKSKDALIATFLFLDQFVWLGRTGIYQNKERVERIGRISLFCWLGSTVCTSLVEIGELGRLSASIKKLEEELKNSNKYENEQYRAKLKKSNDRTLALVKAGIDTVVAVGLLQLAPTKVTPRVTGALGFASSLISCYQLLPPPTKSKTL*
• ORF Type: complete

Annotations of Ll_transcript_250598

• Blastp: Peroxisomal membrane protein 11C from Arabidopsis with 75.72% of identity
• Blastx: Peroxisomal membrane protein 11C from Arabidopsis with 76.61% of identity
• Eggnog: peroxisomal biogenesis factor 11(ENOG4111NS6)
• Kegg: Link to kegg annotations (AT1G01820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460964.1)
• Pfam: Peroxisomal biogenesis factor 11 (PEX11) (PF05648.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;