Transcript | Ll_transcript_249671 |
---|---|
CDS coordinates | 1414-1863 (+) |
Peptide sequence | MPVGTQGTIKGLTNSQLEDIGCQIILGNTYHLALRPTSELLAEAGGLHKFMNWRRAMLTDSGGFQMVSLLHLADITEKGVTFQSPVDGKPMLLTPEESIQIQNRIGADIIMALDDVVKTTITGPRIEEAMYRTLRWIDRCIEGKSVSEG* |
ORF Type | complete |
Blastp | Queuine tRNA-ribosyltransferase catalytic subunit 1 from Danio with 66.43% of identity |
---|---|
Blastx | Queuine tRNA-ribosyltransferase catalytic subunit 1 from Danio with 65.61% of identity |
Eggnog | Exchanges the guanine residue with 7-aminomethyl-7- deazaguanine in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). After this exchange, a cyclopentendiol moiety is attached to the 7-aminomethyl group of 7-deazaguanine, resulting in the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis- dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine) (By similarity)(COG0343) |
Kegg | Link to kegg annotations (393985) |
CantataDB | Link to cantataDB annotations (CNT0000446) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416068.1) |
Pfam | Queuine tRNA-ribosyltransferase (PF01702.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer