Protein coding transcript 207108

• Transcript: Ll_transcript_249662
• CDS coordinates: 1506-2045 (+)
• Peptide sequence: MPVGTQGTIKGLTNSQLEDIGCQIILGNTYHLALRPTSELLAEAGGLHKFMNWRRAMLTDSGGFQMVSLLHLADITEKGVTFQSPVDGKPMLLTPEESIQIQNRIGADIIMALDDVVKTTITGPRIEEAMYRTLRWIDRCIEAHGRPHDQNLFGIVQGGLDPVLRDICIKGLVDRNLPG*
• ORF Type: complete

Annotations of Ll_transcript_249662

• Blastp: Queuine tRNA-ribosyltransferase catalytic subunit 1 from Danio with 63.69% of identity
• Blastx: Queuine tRNA-ribosyltransferase catalytic subunit 1 from Danio with 63.54% of identity
• Eggnog: Exchanges the guanine residue with 7-aminomethyl-7- deazaguanine in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). After this exchange, a cyclopentendiol moiety is attached to the 7-aminomethyl group of 7-deazaguanine, resulting in the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis- dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine) (By similarity)(COG0343)
• Kegg: Link to kegg annotations (393985)
• CantataDB: Link to cantataDB annotations (CNT0000446)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416068.1)
• Pfam: Queuine tRNA-ribosyltransferase (PF01702.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;