Protein coding transcript 207113

• Transcript: Ll_transcript_249474
• CDS coordinates: 831-1355 (+)
• Peptide sequence: MLLSSNYVVFNFILFYCDSIPCSKLCKDIFNSWSNLDDSCFQVEKISGGITNLLLKVSVKEENCIDDIVTIRLYGPNTEFIIDRHRELQAVKYLSAAGFGAKWLGIFGNGMVQSFIDAHTLTPSDIQDPKIAAKIAMELKRFHHVEIPGSKEPQLWNDIWKFFEKGPSYFLPCS*
• ORF Type: complete

Annotations of Ll_transcript_249474

• Blastp: Probable ethanolamine kinase from Arabidopsis with 68.97% of identity
• Blastx: Probable ethanolamine kinase from Arabidopsis with 62.57% of identity
• Eggnog: Ethanolamine kinase(COG0510)
• Kegg: Link to kegg annotations (AT2G26830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415459.1)
• Pfam: Choline/ethanolamine kinase (PF01633.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;