Transcript | Ll_transcript_249477 |
---|---|
CDS coordinates | 572-997 (+) |
Peptide sequence | MAVKYLSAAGFGAKWLGIFGNGMVQSFINAHTLIPSDIRDPKLAAKVAKELRRFHHVDIPGSKEPQLWNDIWKFFEKASVLEFEESKMHKTYETISFREVHDEIVELKGLTDRLNSPVIFSHNDLLSANIMINDDEGTHIP* |
ORF Type | complete |
Blastp | Probable ethanolamine kinase from Arabidopsis with 69.12% of identity |
---|---|
Blastx | Probable ethanolamine kinase from Arabidopsis with 57.14% of identity |
Eggnog | Ethanolamine kinase(COG0510) |
Kegg | Link to kegg annotations (AT2G26830) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415990.1) |
Pfam | Choline/ethanolamine kinase (PF01633.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer