Protein coding transcript 207115

• Transcript: Ll_transcript_249477
• CDS coordinates: 572-997 (+)
• Peptide sequence: MAVKYLSAAGFGAKWLGIFGNGMVQSFINAHTLIPSDIRDPKLAAKVAKELRRFHHVDIPGSKEPQLWNDIWKFFEKASVLEFEESKMHKTYETISFREVHDEIVELKGLTDRLNSPVIFSHNDLLSANIMINDDEGTHIP*
• ORF Type: complete

Annotations of Ll_transcript_249477

• Blastp: Probable ethanolamine kinase from Arabidopsis with 69.12% of identity
• Blastx: Probable ethanolamine kinase from Arabidopsis with 57.14% of identity
• Eggnog: Ethanolamine kinase(COG0510)
• Kegg: Link to kegg annotations (AT2G26830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415990.1)
• Pfam: Choline/ethanolamine kinase (PF01633.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;