| Transcript | Ll_transcript_249479 |
|---|---|
| CDS coordinates | 134-490 (+) |
| Peptide sequence | MVAEVKIWNPIEVAEQARKDYASQILASHLTIDPSLSFPLMKPLIIRLCKDIFKAWSNLDDSFFHVEKISGGITNLLLKVSVKEENCIDDTIAIRLYGPNTEYIIDRHRELQVRGCTG* |
| ORF Type | complete |
| Blastp | Probable ethanolamine kinase from Arabidopsis with 61.36% of identity |
|---|---|
| Blastx | Probable ethanolamine kinase from Arabidopsis with 61.36% of identity |
| Eggnog | Ethanolamine kinase(COG0510) |
| Kegg | Link to kegg annotations (AT2G26830) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415990.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer