| Transcript | Ll_transcript_248337 |
|---|---|
| CDS coordinates | 518-820 (+) |
| Peptide sequence | MKYYFQFVEEMQVPEVDTAVRSLTVMWDGSLVVAANNHGTCYVWRLLQGTQTMTNFEPLHKLQAHKGYILKCLLSPEFCEPHRSYRLCSFCFFILFYHSN* |
| ORF Type | complete |
| Blastp | Target of rapamycin complex subunit wat1 from Schizosaccharomyces with 47.69% of identity |
|---|---|
| Blastx | Target of rapamycin complex subunit wat1 from Schizosaccharomyces with 60.71% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPBC21B10.05c) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019430537.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer