Protein coding transcript 207176

• Transcript: Ll_transcript_248340
• CDS coordinates: 221-745 (+)
• Peptide sequence: MSYDSHTNNVMAVGFQCDGNWMYSGSEDGTVKIWDLRAPGCQREYESRAAVNTVVLHPNQTELISGDQNGNIRVWDLTANSCSCELVPEVDTAVRSLTVMWDGSLVVAANNHGTCYVWRLLQGTQTMTNFEPLHKLQAHKGYILKCLLSPEFCEPHRSYRLCSFCFFILFYHSN*
• ORF Type: complete

Annotations of Ll_transcript_248340

• Blastp: Protein LST8 homolog from Dictyostelium with 64.24% of identity
• Blastx: Protein LST8 homolog from Dictyostelium with 63.49% of identity
• Eggnog: MTOR associated protein, LST8 homolog (S. cerevisiae)(ENOG410XPVD)
• Kegg: Link to kegg annotations (DDB_G0292592)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419702.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;