Protein coding transcript 207246

• Transcript: Ll_transcript_249593
• CDS coordinates: 236-631 (+)
• Peptide sequence: MSHLGNPISDVVEFNKPDFRQLDLGSPVSPLRNRGPTISSSSSSSGSFSGGRIMQNPVPKRSESAPTINNSNHSGELSGSTETSPNNARGGSGSKPGHARSNSGTAAPLIYSGQSVNSPVLNVLPTGNICPS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_249593

• Blastp: Inactive TPR repeat-containing thioredoxin TTL3 from Arabidopsis with 40.85% of identity
• Blastx: Inactive TPR repeat-containing thioredoxin TTL3 from Arabidopsis with 40.85% of identity
• Eggnog: repeat-containing protein(COG0457)
• Kegg: Link to kegg annotations (AT2G42580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425252.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;