Protein coding transcript 207308

• Transcript: Ll_transcript_249105
• CDS coordinates: 195-1280 (+)
• Peptide sequence: MANSEAHDVQSILSSPNRDFLIRNNNDQVKIDSLKGKKVGIYFSASWCGPCRKFTPFLVDVYNELAPKGDFEIIFVTADEDDESFKAYFSKMPWLAIPFSDSDTRNSLDELFQVKGIPHLVLLGETGEVLTDDGTGVIREYGVEGYPFTSARIQELEDQEAEAKRNQTLTSILTSPSRDFLISSDGEKVLVSELEGKTVGLYFTLTSDKEFGDFTQQLVGVYEKLKENGEKFEVVVIPLDIEEESFKEGLQSMPWLSLPFQDKSREKLIRYFELLALPTLVIIGPDGKTLHSNVAEAIEEHGIAAYPFTPEKFAELVELEKAKEASQTLESILVSGDLDFVIGKDGVKVNFLNKLTTSSVE*
• ORF Type: complete

Annotations of Ll_transcript_249105

• Blastp: Probable nucleoredoxin 1 from Arabidopsis with 61.45% of identity
• Blastx: Probable nucleoredoxin 1 from Arabidopsis with 60.51% of identity
• Eggnog: nucleoredoxin-like(ENOG410ZIWC)
• Kegg: Link to kegg annotations (AT1G60420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423440.1)
• Pfam: Redoxin (PF08534.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;