Transcript | Ll_transcript_250036 |
---|---|
CDS coordinates | 3-449 (+) |
Peptide sequence | HRSGSSSSSSSDEEEIGEDGEKKKKKKEKKGLKEKIKEKITHDDEEKKHEDTTVPVEKVEVDPEHQKGFLDKIKEKLPGQHKKTDEVAVPPPSSTVYGGVHSEYDAGVAHEGEAKEKKGLLEKIKEKIPGYHPKTGEEKEKEKESGAY* |
ORF Type | 5prime_partial |
Blastp | Dehydrin COR410 from Triticum with 45.87% of identity |
---|---|
Blastx | - |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453376.1) |
Pfam | Dehydrin (PF00257.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer