| Transcript | Ll_transcript_250037 |
|---|---|
| CDS coordinates | 3-449 (+) |
| Peptide sequence | HRSGSSSSSSSDEEEIGEDGEKKKKKKEKKGLKEKIKEKITHDDEEKKHEDTTVPVEKVEVDPEHQKGFLDKIKEKLPGQHKKTDEVAVPPPSSTVYGGVHSEYDAGVAHEGEAKEKKGLLEKIKEKIPGYHPKTGEEKEKEKESGAY* |
| ORF Type | 5prime_partial |
| Blastp | Dehydrin COR410 from Triticum with 45.87% of identity |
|---|---|
| Blastx | - |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453376.1) |
| Pfam | Dehydrin (PF00257.18) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer